Products

CXCL4 (C-X-C motif chemokine 4), Human

CXCL4, also known as platelet factor 4 (PF-4), is one of the most plentiful platelet chemokines.Depending on the cell type, CSCL4 may has several biological functions. CXCL4 is mainly produced in megakaryocytes, released from the α-granules of platelets as a tetramer at micromolar concentrations depending on platelet activation. CXCL4 has both procoagulant and anticoagulant activities, thereby can bind heparin and neutralize the anticoagulant effect of heparin. In addition, CXCL4 also have functions such as inhibiting factor XII, and vitamin K dependent coagulation factor, and stimulating activated protein C generation. As a strong tumor inhibitor, CXCL4 can inhibit endothelial cell migration, proliferation, and in vivo angiogenesis through interfering with the angiogenic effect of growth factors such as FGF and VEGF.
No. Size Price Qty Status
C01130-5UG 5 ug $108.00 Inquiry
C01130-20UG 20 ug $268.00 Inquiry
C01130-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES with polyhistidine tag at the N-terminus

UnitProt ID:
P02776
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to inhibit human FGF-2-induce proliferation in HUVEC cells. The ED50 for this effect is <5 μg/mL.
 
Purity:
>98% as determined by SDS-PAGE analysis.

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage​:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice

Measure by its ability to inhibit human FGF-2-induce proliferation in HUVEC cells. The ED50 for this effect is <5 μg/mL.
Reviews for CXCL4 (C-X-C motif chemokine 4), Human

Average Rating: 0 (0 Reviews )